General Information

  • ID:  hor005752
  • Uniprot ID:  O45027
  • Protein name:  Diapause hormone homolog
  • Gene name:  PBAN
  • Organism:  Mamestra brassicae (Cabbage moth)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mamestra (genus), Hadeninae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0019236 response to pheromone; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GLWFGPRI
  • Length:  8(1-8)
  • Propeptide:  GLWFGPRIGKRSLRMATEDNRQAFFKLLEAADALKYYYDQLPYEMQADEPETRVTKKVIFTPKLGRSLAYDDKVFENVEFTPRLGRRLADDMPATPADQEMYRPDPEQIDSRTKYFSPRLGRTMNFSPRLGRELAYEMVPSKIRVVRSTNKTQST
  • Signal peptide:  NA
  • Modification:  T8 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A hormone that controls sex pheromone production in females and pheromone responsiveness in male. Also mediates visceral muscle contractile activity (myotropic activity) (By similarity).
  • Mechanism:  Juvenile hormone seems to allow PBAN release, which then induces pheromone biosynthesis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O45027-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005752_AF2.pdbhor005752_ESM.pdb

Physical Information

Mass: 107017 Formula: C47H68N12O9
Absent amino acids: ACDEHKMNQSTVY Common amino acids: G
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: 41.25 Boman Index: 211
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.5
Instability Index: 2892.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  9684333
  • Title:  cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.